PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa014027
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 287aa    MW: 31181.4 Da    PI: 5.9307
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58681232PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-38235PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.54.1e-30237287151
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                kpr+rWtpeLHe+Fveav++LGGse+AtPk +l+ mkv+gLt++hvkSHLQ
  Lsa014027 237 KPRMRWTPELHEAFVEAVNKLGGSERATPKGVLKQMKVDGLTIYHVKSHLQ 287
                79************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.384234287IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-27235287IPR009057Homeodomain-like
SuperFamilySSF466895.91E-15235287IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-22237287IPR006447Myb domain, plants
PfamPF002498.3E-9239287IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MEAQSALAFR RSGARQLSNH GAPGARSSPF PIRPASLENK HPKFPDSQAQ QISMGTQNFT  60
ALPSVSSTNG AVGHIFSSST SGMSSDLHFS SVTSHQKHSE TPPFISQSSG VLQSTTYMKE  120
NNNNSSWCTD SLPDFLDYPQ DNAPIQSSNL QEDLGKQNDW QDWADQLITE DDAMTPDWNE  180
ILIDTNIIEP EPKMAYHVGG SSTNSMQIQA IPASSGEACI PLTPTPSSCG NSGSHSKPRM  240
RWTPELHEAF VEAVNKLGGS ERATPKGVLK QMKVDGLTIY HVKSHLQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012830829.12e-94PREDICTED: protein PHR1-LIKE 1-like isoform X1
TrEMBLA0A103Y7E01e-133A0A103Y7E0_CYNCS; Homeodomain-like protein
STRINGVIT_07s0005g04120.t018e-93(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.19e-58phosphate starvation response 1